Protein Info for Dshi_3313 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF16867: DMSP_lyase" amino acids 49 to 207 (159 residues), 180.2 bits, see alignment E=1.2e-57

Best Hits

Swiss-Prot: 73% identical to DDDL_RHOS4: Putative dimethlysulfonioproprionate lyase DddL (dddL) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3313)

MetaCyc: 50% identical to dimethylsulfoniopropionate lyase (Sulfitobacter sp. EE-36)
Dimethylpropiothetin dethiomethylase. [EC: 4.4.1.3]

Predicted SEED Role

"Dimethylsulfoniopropionate (DSMP) lyase DddL"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNF2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Dshi_3313 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MPDLPNPETPAEASALRLMDCPNWVYLLREFDALYRYGSAGGSPAIRSHRKRVRDRLSAV
LAANPAMVDRPRETKPVVAHFARALDLGERAAMQGMVRALREVKDDLTWEYGYEKVPKAL
AQKYAYCEVLGPRGPVQGTTLTLGFVLFAPNTTYPQHSHHDIEESYTSVSGAWSENNAAV
FAPGSLILNTSGHEHRITTGDRDPCLLAYAWAGPAERLATPDMKLTAPRRARGAGV