Protein Info for Dshi_3202 in Dinoroseobacter shibae DFL-12

Annotation: uracil-xanthine permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 395 to 410 (16 residues), see Phobius details amino acids 422 to 444 (23 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 19 to 443 (425 residues), 337.9 bits, see alignment E=9.2e-105 PF00860: Xan_ur_permease" amino acids 23 to 410 (388 residues), 287.2 bits, see alignment E=8.6e-90 TIGR03173: xanthine permease" amino acids 27 to 445 (419 residues), 426.5 bits, see alignment E=9.5e-132

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to dsh:Dshi_3202)

Predicted SEED Role

"Uracil-xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM26 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Dshi_3202 uracil-xanthine permease (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDATIGTPEQLRDPNYTPPLHKAVPLGIQHVLAMFVSNVTPAIIICGAAGFGFGSNSPD
FPQMIYMIQMSMFFAGVATLFQTIGLGPVGARLPIVQGTSFAFIPIMIPLVAGKGVDAIA
VVMGGVIVGGLFHACLGLFIGKIRFALPPLVTGLVVTMIGLALVKVGIQYAAGGVPAIGT
EQYGSLLNWTMALVVIFVTLGLKFFARGMLSVSAVLIGLLAGYVYAFTLGEVSLDNVARA
ATFALPNPFHFGVEFTAAAIIGFCLMAFVSAVETVGDVSGITKGGAGREATDKEIEGATY
ADGVGSAISGVFGALPNTSFSQNVGLIAMTGVMSRHVVTIGALFLIAAGVVPKVGAVVSS
IPIEVLGGGVIVMFGMVVAAGISMLSDVRWNRRNMVIFAISLSVGLGLQQEPGALQHLEG
TIKVLLTSGLLPAALIAIVLNLILPDELSDEATEEVSGGMAGHGHGELVKDDHV