Protein Info for Dshi_3184 in Dinoroseobacter shibae DFL-12

Annotation: Nitric-oxide reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details amino acids 414 to 438 (25 residues), see Phobius details PF00115: COX1" amino acids 7 to 424 (418 residues), 243.4 bits, see alignment E=2.3e-76

Best Hits

Swiss-Prot: 56% identical to NORB_PSEAE: Nitric oxide reductase subunit B (norB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04561, nitric oxide reductase, cytochrome b-containing subunit I [EC: 1.7.2.5] (inferred from 100% identity to dsh:Dshi_3184)

MetaCyc: 78% identical to nitric oxide reductase large subunit (Paracoccus denitrificans)
1.7.9.-; NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit B (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM08 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Dshi_3184 Nitric-oxide reductase (RefSeq) (Dinoroseobacter shibae DFL-12)
MKYESQKIAYAYFATALGLFAIQVIGGLLAGWVYVSPNTLSELVPFNTIRMLHTNSLIVW
LLLGFFGAAYFLIPEEAEREIHSPMLAYVQLAILVVGTLGVVVTYLFNPFEGHWLLGKEG
REFIEQPKWVKAGIVVAALIFLYNVSMTSLKGRKTAITNILLLGLWGLALLFLFSFYNPH
NLSLDKMYWWYVVHLWVEGVWELIMASILAYLMLKLTGVDREVVEKWLYVIVAAALFSGI
LGTGHHYYWIGTPGYWQWIGSIFSSLEVIPFFAMMAFAFVMVWKGRRDHPNKAALLWSLG
TATLAFFGAGVWGFLHTLHGVNYYTHGTQITAAHGHLAFFGAYVALNLAIISYAMPILKG
RDPYNQVLNMASFWMMAGGMTFMTFVLTFAGTVQTHLQRVMGIDYMSVQDDITIFYWMRF
GSGVVVVLGALLFIYAIFVPRKEIIEPNDRSVAAETPAE