Protein Info for Dshi_3143 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 288 (202 residues), 62.8 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to dsh:Dshi_3143)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLW7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MRDNTLKYFLVLPAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFE
EPAFWNSVYVTALYTVVTVGLTTLLALGLALLLAPGGRLRVSAQTLLILPFAMSPALIGV
SFRFMFNPEFGLFDAFFGVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGL
ASVPRDTIEAAQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGP
GTATQTLSHYIYFNGMKYGQIGYSASVAWLMVIPMIFLTYAYAKFVFRKN