Protein Info for Dshi_3142 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 183 to 208 (26 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 269 (185 residues), 72.2 bits, see alignment E=2.4e-24

Best Hits

Swiss-Prot: 33% identical to YJ16_PYRHO: Probable ABC transporter permease protein PH1036 (PH1036) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to dsh:Dshi_3142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLW6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Dshi_3142 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MTGKQRKQFWSAVHAVLIIAAMFVMLVPILWIFLAAFKSHVDVYQLKLFFTPTLENFGTV
FDDPYRLGEKLFNSTVVALVTVVIAIPIATLAAYSFSRFRLVGETAMLVVILATQFLPAV
VIILPFFIMFRDIGLLDTRLGLILVNLAIVMPFAIWMIKGFIDGIPLDTEEAAMVDGSSR
LQVIWNIVLPMAAPGLLTSGIFCFIIAWNEFLFALILTNKDAVTLPIGLALFKGEEGDLW
NLLSAAGIIIMAPMFVLALMIRKYFVQGMTMGAVR