Protein Info for Dshi_3103 in Dinoroseobacter shibae DFL-12

Annotation: molybdopterin biosynthesis MoaE protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 5 to 118 (114 residues), 116.7 bits, E=3.1e-38

Best Hits

Swiss-Prot: 68% identical to MOAE_RHOS4: Molybdopterin synthase catalytic subunit (moaE) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to dsh:Dshi_3103)

MetaCyc: 50% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A8LL87 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Dshi_3103 molybdopterin biosynthesis MoaE protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTVRVQQAPFALGAELDSFAAGRTDMGAIVSFTGVVRDVATGDLDVMEIEHYPGMTERAI
GKIVDEAKARWSLGDALVIHRYGRMGPGDRIMMVATAAPHRVDAFAAAEFLMDYLKSRAP
FWKKEISGAGASWVAATDEDEAALTRW