Protein Info for Dshi_3013 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF606 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 7 to 143 (137 residues), 129.4 bits, see alignment E=5.9e-42

Best Hits

KEGG orthology group: K09936, hypothetical protein (inferred from 100% identity to dsh:Dshi_3013)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKG3 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Dshi_3013 protein of unknown function DUF606 (RefSeq) (Dinoroseobacter shibae DFL-12)
MTYWLAIGAIALGGAGIALQAPINAQLARASGDPVVAAAISFGVGFVVLCSIVAVRGTVP
GWSAMGGLPWWAWCGGALGAVYVWAAAWSVDRIGVVTLVAALVFGQLLTALLLDAIGAFG
MAMREVSPTRIAAVVLVGAGLLLSRL