Protein Info for Dshi_2891 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00106: adh_short" amino acids 6 to 186 (181 residues), 154.6 bits, see alignment E=3.6e-49 PF01370: Epimerase" amino acids 9 to 92 (84 residues), 22.4 bits, see alignment E=1.1e-08 PF13561: adh_short_C2" amino acids 15 to 239 (225 residues), 198.2 bits, see alignment E=2.4e-62

Best Hits

Swiss-Prot: 38% identical to YXBG_BACSU: Uncharacterized oxidoreductase YxbG (yxbG) from Bacillus subtilis (strain 168)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to dsh:Dshi_2891)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.14

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJM1 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Dshi_2891 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MRLEGKTAIVTGGGSGFGAGIVRKFAAEGAQVIVADINKGAAEAVAEEYGGTAAQVDVSD
ADSMAALAEAHGAPDILVNNAGITHLPKPMEEVTEEEFDRVLAVNAKSVYLSARVFVPAM
KARGSGAILNIASTAGVSPRPKLNWYNASKGWMITATKAMAVELAPFGIRVNALNPVAGE
TPLLASFMGEDTPEMRAKFLATIPLGRFSQPEDLGNAAAFLCSDEASMITGVAMEVDGGR
CI