Protein Info for Dshi_2887 in Dinoroseobacter shibae DFL-12

Annotation: succinic semialdehyde dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to DAVD_PSEAE: Glutarate-semialdehyde dehydrogenase (davD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00135, succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (inferred from 100% identity to dsh:Dshi_2887)

MetaCyc: 65% identical to glutarate semialdehyde dehydrogenase (Pseudomonas aeruginosa)
Glutarate-semialdehyde dehydrogenase. [EC: 1.2.1.20]

Predicted SEED Role

No annotation

MetaCyc Pathways

4-aminobutanoate degradation III (1/2 steps found)
L-lysine degradation X (3/6 steps found)
L-lysine degradation IV (2/5 steps found)
L-lysine degradation I (2/7 steps found)
L-lysine degradation III (1/6 steps found)
superpathway of L-lysine degradation (9/43 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.16 or 1.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJL7 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Dshi_2887 succinic semialdehyde dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MLDTVTELREHLKDPALLASKAYFAGAWTDADSGATFPVTNPARGDVIAHVPDLGRAETA
RAIAAADAAQKPWAARTAKDRAQVLRRWFDLIVGNADDLARILTAEMGKPLAEARGEVMY
GASFVEWFAEEAKRLYGETIPGHLPDARIQVIRQPIGVVGAITPWNFPIAMITRKAAPAL
AAGCAFLSKPAEDTPLSALALAVLAERAGIPAGLFAVLPSSDSSAIGKEFCENHTVRKLT
FTGSTQVGRILLAQAADQVKKCSMELGGNAPFIVFDDADLDKAVEGAMACKFRNAGQTCV
CANRIYVQDGVYDAFAEKLAAAVEELKVGDGAAEGVTIGPLINMPAVEKVQDHLDDLRAK
GGTVVTGGETHPLGGTFFTPTVVTGVTQEMKVAREETFGPVAPLFRFTEEDEVIAMANDT
IFGLAGYFYARDIGRITRVSEALEYGIVGINTGIISTEGAPFGGVKQSGLGREGSRHGID
EYLEMKYICLSI