Protein Info for Dshi_2866 in Dinoroseobacter shibae DFL-12

Annotation: Succinate dehydrogenase hydrophobic membrane anchor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 59 to 78 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details PF01127: Sdh_cyt" amino acids 8 to 109 (102 residues), 50.9 bits, see alignment E=8.6e-18 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 16 to 118 (103 residues), 45.2 bits, see alignment E=4.5e-16

Best Hits

Swiss-Prot: 47% identical to DHSD_PARDE: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Paracoccus denitrificans

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 100% identity to dsh:Dshi_2866)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJJ6 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Dshi_2866 Succinate dehydrogenase hydrophobic membrane anchor (RefSeq) (Dinoroseobacter shibae DFL-12)
MGFMTDRKRAMGLGSAKSGTEHHWHMQVSSVGLLILVPLFLFTFGRVVGAPYEEVIAYLA
RPFPAIVTALMLVVGFDHFRHGVTVAIEDYAQGTTRKALIIAMTCVSYGAMATGLFAIAR
LAL