Protein Info for Dshi_2846 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 83 (43 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 300 (290 residues), 132.2 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to dsh:Dshi_2846)

Predicted SEED Role

"Predicted nucleoside ABC transporter, permease 2 component" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ84 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Dshi_2846 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MDFATLLQVLDSTIRLATPLLLACLAGLFSERAGIFDIGLEGKMLVAAFLSAAMAAITGS
VWIGLFAGVFAALLFSAIHGLASITFRGNQLISGVALNFLAAGLTVLIAQSWFSQGGRTP
SLIGGARFEPITLPFAEALQNVPILGPIYYELISGHTILVYVALLAVPATWYILFRTRFG
LRLRAVGENPAAVDTAGISVVGLRYAAVAICGLLCGLAGAYLATGLSAGFVKDMTAGRGY
IALAALIFAKWRPWYALMACLLFGFLEAIANRFQNIEILSIPIPVQLMQALPYILTVVIL
AGFVGKAIPPRAGGEPYVKER