Protein Info for Dshi_2825 in Dinoroseobacter shibae DFL-12

Annotation: 3-hydroxyacyl-CoA dehydrogenase NAD-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF02737: 3HCDH_N" amino acids 5 to 170 (166 residues), 79.4 bits, see alignment E=3.3e-26 PF13279: 4HBT_2" amino acids 249 to 366 (118 residues), 94.3 bits, see alignment E=7.4e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2825)

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" in subsystem Acetyl-CoA fermentation to Butyrate or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 1.1.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ63 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Dshi_2825 3-hydroxyacyl-CoA dehydrogenase NAD-binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MDRTAAIIGSGRIGSGWAARFLLFGWHVRVFDADPGAQARLTQVIEAARTSLLGLYDTPL
PPPGRLSQHGSIAEAVAGAVWVQESVPEDLSLKREVVREVQAHGPEAIVASAASDIPLEA
LREGAARPERVVIARAVAPVYLLPPVVLEARDAACGAQAEAVLRGIGMTPLQGEQTLGPE
GTQIAAALGLAAEQGPATDARRDATLVGVLRALKAEGRGVGAAFAATDRARMPAPGAESA
PLLTAARVVPADWADYNGHMTEARYLHAFGNATDRFMELIGVDAAYLASGGSFFTAETHI
RHLGEMRIGAAFEIRTTCLAGAGKRMHLWHEMRCDGRLVATGEHMLIHVSLRTRRPAPPA
APVAANLARIAAAHARLARAEGVGRAIGDPR