Protein Info for Dshi_2797 in Dinoroseobacter shibae DFL-12

Updated annotation (from data): Fructokinase (EC 2.7.1.4)
Rationale: Important for utilizing Sucrose, which is catabolized via fructose.
Original annotation: PfkB domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 23 to 302 (280 residues), 146.1 bits, E=7.6e-47

Best Hits

Swiss-Prot: 52% identical to SCRK_RHILT: Fructokinase (frk) from Rhizobium leguminosarum bv. trifolii

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to dsh:Dshi_2797)

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

• sucrose degradation III (sucrose invertase) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• D-sorbitol degradation I (3/3 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• mannitol cycle (3/5 steps found)
• heterolactic fermentation (12/18 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4

Sequence Analysis Tools

See A8LJ35 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Dshi_2797 Fructokinase (EC 2.7.1.4) (Dinoroseobacter shibae DFL-12)
MILCAGEALIDMLPRALPDGTAGFAPVAGGAVFNTAVALGRLGADVGLVTGLSRDLFGEV
LMTALAAADVDSDMAVLSDRPTTLAFVTLTDGHAQYAFYDENTAGRMLAPADMPDPGPEV
GTLFFGGISLAVEPCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTFRARIDRMLAVT
DIVKVSDEDLAWLMGPGDLAESAAALRARGPAVVCVTRGGAGVEAHTATGITHVAAEAVE
VVDTVGAGDTFNAGFLAGLAEAGALDKDRLRALDAPVLTSALRLGAQAAAITVSRAGANP
PWRDELPR