Protein Info for Dshi_2783 in Dinoroseobacter shibae DFL-12

Annotation: N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01510: Amidase_2" amino acids 2 to 124 (123 residues), 122.7 bits, see alignment E=6.5e-40

Best Hits

KEGG orthology group: K01447, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 100% identity to dsh:Dshi_2783)

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ21 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Dshi_2783 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD (RefSeq) (Dinoroseobacter shibae DFL-12)
MPRLVVLHYTAMADAQGAADWLCAPRAQVSAHYVIGRDGAVMRLVPEHLRAWHAGAGAWG
GCTDVNSASIGIELDNDGTSPFSAPLMDALEGLLGDILTRHGIPRKGVIGHSDLAPGRKI
DPGPRFDWRRLARRGLSIWPEGAAAGAAPDPARFAADLARFGMTAEVDAETRLAAFRARF
RPGATGPLAPEDMGLAADLAARWPVDPPPVSG