Protein Info for Dshi_2762 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF28 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 321.2 bits, see alignment E=2.4e-100 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 113.5 bits, see alignment E=5.1e-37 PF01709: Transcrip_reg" amino acids 81 to 236 (156 residues), 212.6 bits, see alignment E=2.8e-67

Best Hits

Swiss-Prot: 100% identical to Y2762_DINSH: Probable transcriptional regulatory protein Dshi_2762 (Dshi_2762) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2762)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ00 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Dshi_2762 protein of unknown function DUF28 (RefSeq) (Dinoroseobacter shibae DFL-12)
MAGHSKWANIQHRKGRQDKLRAKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQS
VPKDVIERAIKKSLGGEGENYDEIRYEGYGPGGVAVIVEAMTDNRNRTASTVRSTFSKNG
GNLGETGSVSFMFERKGQVSYPAEAGDADTVMMAAIEAGAEDVESDESGHIIWCADTDLN
EVSTALEAELGESESTKLVWRPTTTTELDLEGMQKLMKLLDALEDDDDVQNVTANFEASD
EVMAQL