Protein Info for Dshi_2753 in Dinoroseobacter shibae DFL-12

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 356 to 385 (30 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF06808: DctM" amino acids 8 to 417 (410 residues), 400.2 bits, see alignment E=5e-124 TIGR00786: TRAP transporter, DctM subunit" amino acids 16 to 422 (407 residues), 431.9 bits, see alignment E=1.1e-133

Best Hits

Swiss-Prot: 40% identical to Y050_HAEIN: Putative TRAP transporter large permease protein HI_0050 (HI_0050) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2753)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIP5 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Dshi_2753 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MLIWFLPLFLLFLMIGLPVFFGLLAAPGLLLWLNGQERDITLLYRNVYNGMDSFPLMAIP
FFMLAGELMNRGGITLRLVEFAQALMGHFRGGLAHVNILSSMLFAGLSGSAVADTSALGS
MLIPAMEKQGYTRRFAAAITAASSVIGPIIPPSGIMIIYAYVMGESVAALFLAGIVPGIL
VGVGLMGVVKLMADKYDFPVASAKTTWGQRGQASLKAFFPLMTPVIILGGILAGVFTPTE
AAAVAVAYALIIGFFVMRTLKVSDLPDILGRAGITSAVVLLLVGAAMAFKTVVSLSYAPQ
IMADFMLSLSENPLILLLLINLLLFVVGMFLDAGPAIIILGPILGPIFVDLGVDPIHFAI
IMSVNLTVGLATPPMGLVLFVASSVSGERVERIAKAILPFLAVEILVIFLITYFPAISMT
IPRLTGFAQ