Protein Info for Dshi_2737 in Dinoroseobacter shibae DFL-12

Annotation: pyridine nucleotide-disulphide oxidoreductase dimerisation region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF07992: Pyr_redox_2" amino acids 5 to 349 (345 residues), 221 bits, see alignment E=6e-69 PF12831: FAD_oxidored" amino acids 6 to 45 (40 residues), 27.8 bits, see alignment 4.1e-10 PF00070: Pyr_redox" amino acids 169 to 240 (72 residues), 71.7 bits, see alignment E=1.5e-23 PF02852: Pyr_redox_dim" amino acids 369 to 476 (108 residues), 114.4 bits, see alignment E=7.9e-37

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to dsh:Dshi_2737)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIM9 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Dshi_2737 pyridine nucleotide-disulphide oxidoreductase dimerisation region (RefSeq) (Dinoroseobacter shibae DFL-12)
MSFDYDLFVIGGGSGGVRAARVAAAEGAKVALAEEYRMGGTCVIRGCVPKKLMVFASGYR
EMPGEARAYGWDVPDGVFDWVPFRDKLHSELDRLEQVYRGLLKGSEVEVFDTRATLKDPH
TVALADGGTKTAKHILIATGGHPVRPDLPNAELGITSNDIFNFETLPKSILIIGGGYIAC
EFACILNGLGVEVTQFYRGAQVLRGFDDEARGLVAESMREKGIGLHLGTNIVEMRAAADA
ENATTLTGTDPAMGAPAQEAEALTPKARKGGPIWVKATNGMTGVYDQVLFATGRDPSTEG
LGLEAAGVETGRRGEILVDAYSQTSVPSIYAIGDVTNRVQLTPVAIREGMAFVETVFKGN
PTKPDHDLIPSAIFTQPELGTIGMSEEEAREQEPVDIYCTSFRAMREAFAGKTDRVLMKL
VVSKATDKVLGCHIVAEHAGEMIQLAGIAVKMGATKADFDRVCAVHPTISEELVTMKSPV
RSA