Protein Info for Dshi_2728 in Dinoroseobacter shibae DFL-12

Annotation: phosphoribosylamine--glycine ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02844: GARS_N
  • amino acids 1 to 100 (100 residues), 124.5 bits, E=4.1e-40
• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 420 (420 residues), 518.3 bits, E=7.3e-160
• PF01071: GARS_A
  • amino acids 101 to 292 (192 residues), 251.8 bits, E=7e-79
• PF02843: GARS_C
  • amino acids 327 to 418 (92 residues), 108 bits, E=3.7e-35

Best Hits

Swiss-Prot: 60% identical to PUR2_AGRFC: Phosphoribosylamine--glycine ligase (purD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to dsh:Dshi_2728)

MetaCyc: 53% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See A8LIM0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Dshi_2728 phosphoribosylamine--glycine ligase (RefSeq) (Dinoroseobacter shibae DFL-12)
MNILILGSGGREHSLAWAAAQNPKCDRLIVAPGNAGMAEIAECAMLDIEDPGAVASFAAD
AAIDFVIIGPEAPLAAGVADRLREAGVLCFGPSAAAAQLEASKTFTKQICDATGAPTAAY
AHFTDAAAARAYVQAQGAPIVVKADGLAAGKGVIVAMTEAEALAAVDDMFGGAFGGAGAE
VVIEEFMTGEEASFFVLCDGETVLPIGSAQDYKRAFDGDKGPNTGGMGAYSPAPVLTDAI
AAQALDEIIRPCMAEMTRRGMPYQGVLYAGLMIADGRARLVEYNARFGDPECQVLMMRLG
AQALDLMLACAEGRLDAAQVTWADDHALTVVMAAKGYPGGYEKGTEIRGLDDLVEDSFRM
VFHAGTKRASGRLEAHGGRVLNVTARADTLAEAQASAYAMVDAIDWPEGFCRRDIGWRAL