Protein Info for Dshi_2643 in Dinoroseobacter shibae DFL-12

Annotation: D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00389: 2-Hacid_dh" amino acids 6 to 316 (311 residues), 76.5 bits, see alignment E=3.3e-25 PF02826: 2-Hacid_dh_C" amino acids 109 to 285 (177 residues), 194 bits, see alignment E=3.1e-61 PF03446: NAD_binding_2" amino acids 149 to 254 (106 residues), 34.7 bits, see alignment E=3.8e-12 PF03807: F420_oxidored" amino acids 149 to 209 (61 residues), 23.8 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 43% identical to GYAR_THEGJ: Glyoxylate reductase (gyaR) from Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2643)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LI42 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Dshi_2643 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MKLLISRPLPEAVLARARARFDCTLRETTQPMRAEELRGALRDYDLVLPTLGDAFSAEVF
ADVPEPRARLLANFGVGYNHIDAVAARAAGVAVTNTPGAVTDATADTALTLILMAARRAG
EGERLVRAGTWTGWHPTQMLGLHVTGKTLGVIGMGRIGQAIAARCHHGFGMEVVFYNRSP
KTPDLPARQLASVAEVMAAADIVVVAVPGGAETHHLIGAEAFAAMQPHAVFVNIARGDVV
DEAALIAALQAGQLGAAGLDVYEFEPAVPEALIGMENVVLLPHLGTAALEVREAMGHMAL
DNLIACAEGAPLPNPV