Protein Info for Dshi_2600 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF6 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00892: EamA" amino acids 9 to 142 (134 residues), 55.1 bits, see alignment E=4.7e-19 amino acids 157 to 286 (130 residues), 27.4 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2600)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHZ9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dshi_2600 protein of unknown function DUF6 transmembrane (RefSeq) (Dinoroseobacter shibae DFL-12)
MTRPDNPSLGIALRILSGVLFTGMVVCVKALSDAAPLGQIVFFRSFFALIPLVIFLMVRH
EFPGGLRTKRPIGHLVRSFFGAAAMFTSFASVALLPLAEAVLLAQLAPVLTAITAVVVLS
ERLTKWRVIGLAFGLAGVLVLVWPDIGGGTVDTQRFLGIGLGLLTALLTAFALIMVRSLT
RTESPGAIAFYFVVASMAGGILTLPWGWAFPDSQTLMLLILAGLFGGFAHIAMTLSFSYT
EASRLAPFEYVALLWPVLADLLIFKLPLSGSFLLAMPLVLAGAAVAALEGKRRTRNAA