Protein Info for Dshi_2443 in Dinoroseobacter shibae DFL-12

Annotation: 6-phosphogluconate dehydrogenase NAD-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03807: F420_oxidored" amino acids 6 to 95 (90 residues), 32.5 bits, see alignment E=1.7e-11 PF03446: NAD_binding_2" amino acids 6 to 158 (153 residues), 112.3 bits, see alignment E=3.8e-36 PF14833: NAD_binding_11" amino acids 165 to 275 (111 residues), 65.4 bits, see alignment E=8.7e-22

Best Hits

Swiss-Prot: 32% identical to GARR_ECOL6: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2443)

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LS84 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dshi_2443 6-phosphogluconate dehydrogenase NAD-binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MSLPAVGFIGVGMMGAGMAGCLLSAGHPVTLLAHRNRAPLTPLLDRGAREAPDAVTLLDG
CDVLFTCLPDAEAVAGLADTLLPHTRPGQIWIDTTTSRPETSATLAHRLDAAGAVFSDAP
VTGGPKQAQDGALTSLVGCAAAQFDTIASLVGTYSTAIRRFGDAGTGHAAKLLNNLVTQG
TMVLLSDAFQAAGRLGVDPRALYEVMMTGAARSGTLQKAVPPALDGDYTGARFSISNAAK
DLGYAEALLADALPGRADVAGALAARLGALAAQGRGAEFVTTLFDPNRP