Protein Info for Dshi_2431 in Dinoroseobacter shibae DFL-12

Annotation: Monosaccharide-transporting ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 57 to 100 (44 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 315 (254 residues), 128.7 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 34% identical to ARAH_SHIFL: L-arabinose transport system permease protein AraH (araH) from Shigella flexneri

KEGG orthology group: K10561, rhamnose transport system permease protein (inferred from 100% identity to dsh:Dshi_2431)

MetaCyc: 34% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 1" in subsystem L-rhamnose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LS72 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dshi_2431 Monosaccharide-transporting ATPase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSTADRMIPDRLRSPMEQRLKSWETLLLLVAIGIFVANSFASPYFLNAWNLSDATFNFTE
KAMIAFAMALLIISGEIDLSVASIIALASTAMGAAVQMGVGTPGLVLIGLGVGLLCGAFN
GVLVTRMGLPSIVVTIGTMSLFRGISYIVLGDQAFRGYPESFSWFGQGYVWWVISFELVL
FAIIAVIYAMLLHKTNFGRAVYAIGNNATGAMFSGIRVQRVKFILFLLTGLMSGVAAICL
TARLGSTRPSIAMGWELEVVTMVVLGGVSILGGSGTILGVVIAAFVMGLVTFGLGLLNVP
GIVMSIVIGALLIGVIALPRLWSMWRAR