Protein Info for Dshi_2375 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF1194 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF06707: DUF1194" amino acids 23 to 230 (208 residues), 261.8 bits, see alignment E=1.6e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2375)

Predicted SEED Role

"vWFA-like protein with metal ion dependent adhesion motif (MIDAS)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRT0 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Dshi_2375 protein of unknown function DUF1194 (RefSeq) (Dinoroseobacter shibae DFL-12)
MAWILAFVFAALLAGPSGAEDVEVDVELLLAVDVSRSMTPAELEIQRRGYAEALRSDEVI
SALQGGLLGRVALSYVEWAGAGAQRIVVDWTLIEDRAGAEAFAAKLDTQFNPALRRTSIT
GAIAFGRESLNGNAFAGLRRVIDISGDGPNNQGGLVTLARDRAVAEGIVINGLPLMTVEV
PRSRWHLDDLDIYYRTCVIGGPGSFVIPVTSWADFAQAVRRKLVLELVGTSPAPTPRPVQ
YRPGPNDARDCQIGEKIWERNRGIWGTP