Protein Info for Dshi_2362 in Dinoroseobacter shibae DFL-12

Annotation: Urease accessory protein UreF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF01730: UreF" amino acids 36 to 168 (133 residues), 102.7 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 100% identical to UREF_DINSH: Urease accessory protein UreF (ureF) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03188, urease accessory protein (inferred from 100% identity to dsh:Dshi_2362)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRR7 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Dshi_2362 Urease accessory protein UreF (RefSeq) (Dinoroseobacter shibae DFL-12)
MIAARLRLSQWLSPSFPVSGYAYSHGLEQAISTGDIADAEDLLAWLQALLTSGACQADGV
LVARAAAGDPLEPLCEAAEALAGSAERWSETRDQGAAFVSTTNALCDTALRPMPYPVAVG
ARARALGLPVGEVVALYLQAFLGNLISGAVRLIPLGQTEGQQVSQSLHPTISTQARCLAT
RPLSEIGTGAVRAELAAMAHETQEVRIFRT