Protein Info for Dshi_2360 in Dinoroseobacter shibae DFL-12

Annotation: urease accessory protein UreG (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03308: MeaB
  • amino acids 7 to 196 (190 residues), 32.1 bits, E=6.4e-12
• TIGR00101: urease accessory protein UreG
  • amino acids 7 to 199 (193 residues), 299.4 bits, E=6.1e-94
• PF02492: cobW
  • amino acids 9 to 179 (171 residues), 131.5 bits, E=2.7e-42

Best Hits

Swiss-Prot: 100% identical to UREG_DINSH: Urease accessory protein UreG (ureG) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to dsh:Dshi_2360)

MetaCyc: 57% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (3/8 steps found)

Sequence Analysis Tools

See A8LRR5 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dshi_2360 urease accessory protein UreG (RefSeq) (Dinoroseobacter shibae DFL-12)
MSEHGPLRIGIGGPVGAGKTTLTERLCAALRDDYSVAVITNDIYTSEDAEYLMRAQALPL
ERIRGVETGGCPHTAIREDASINLAAVADLRASFADLDVILIESGGDNLAATFSPELADL
TIYVIDTAAGQDIPRKKGPGLARSDLLVINKTDLAPHVDVDLALLESDARTARGARPFVM
AALKSGQGVAQIVAFLEREGGL