Protein Info for Dshi_2296 in Dinoroseobacter shibae DFL-12

Annotation: transposase IS4 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 122 to 140 (19 residues), see Phobius details PF01609: DDE_Tnp_1" amino acids 5 to 133 (129 residues), 57.2 bits, see alignment E=3e-19 PF13612: DDE_Tnp_1_3" amino acids 14 to 115 (102 residues), 41.9 bits, see alignment E=1.6e-14 PF13586: DDE_Tnp_1_2" amino acids 55 to 135 (81 residues), 65.2 bits, see alignment E=9.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2296)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRK1 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Dshi_2296 transposase IS4 family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSREGGRTECGMNTKLHAICDRQGRPLNLFVTAGQVSDYIGARALLSSLPDVDWLLGDRG
YDADWFREALEDKGIRACIPGRKQRKKTVKYDKRRYKRRNRIEIMFGKLKDWRRVPTRYD
RCPKVFLSAVALAATSFIGYEA