Protein Info for Dshi_2293 in Dinoroseobacter shibae DFL-12

Annotation: secretion protein HlyD family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details PF25917: BSH_RND" amino acids 51 to 233 (183 residues), 48 bits, see alignment E=2.3e-16 PF25885: HH_EMRA" amino acids 89 to 204 (116 residues), 39.6 bits, see alignment E=1.5e-13 PF25876: HH_MFP_RND" amino acids 115 to 179 (65 residues), 25.1 bits, see alignment E=4.3e-09 PF25954: Beta-barrel_RND_2" amino acids 243 to 282 (40 residues), 26.5 bits, see alignment 1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2293)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRJ8 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Dshi_2293 secretion protein HlyD family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSETQTSPPSGGSPARTVALVVVVALVLIAGLYALMDRYVPSSPRGIVSANVVQIAPRVS
GTITRVHVADDAIVEAGDPLFSLDPRPFELAVRQAEANLNTALQTVDASGASLVAAQAAV
TQARTALENTQAEADRTFQLEERGIVATARGDDARAAVESAQAQLDQAEANLDSARAQLG
PEGADNPTIQAATAQLEQAQYDLASTTVTAPHLGVVTNVTLSEGQFIGAGSPALTFIDAE
AGWITVDLRENQLQKIEAGDPARVLFDALPGRIFEGRVQSIAWGIAPRRTVQGGLVANQQ
TTQWFEPARTIPVRIELEGGMENWPYAVRVGGKVHAVIFSESETGPIAWVARGLQRLRSW
LSYLH