Protein Info for Dshi_2284 in Dinoroseobacter shibae DFL-12

Annotation: beta-lactamase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2284)

MetaCyc: 74% identical to methyl acetate hydrolase (Gordonia sp. TY-5)
RXN-17572 [EC: 3.1.1.114]

Predicted SEED Role

"1,4-butanediol diacrylate esterase"

MetaCyc Pathways

propane degradation I (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.114

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR97 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Dshi_2284 beta-lactamase (RefSeq) (Dinoroseobacter shibae DFL-12)
MGHTFNADDILNRVVTSEPRVPGVVAMVADRDRNIYEGAAGVRRIDGDTAMGVDDAFAIF
STTKAITATAALQLVEEGRLDLDAPASDYAPDIGKLQVIEGFDDAGEPILRAPKRPVTTK
HLLLHTGGFGYDFFSETYNRLAQEKGQPSVITASKASLMTPLQFDPGDKWEYGSNIDWVG
QVVEGITGKRLGEVFQTRIFDPLGIEDMTFELNDGLRSRLAGMHARGEDGSLTPMEFELT
DTPEIHMGGHGLYGTAGDYMKFIRMWLNDGMGPNGRVLKPETVAMAEKNHLGEMKIGMLP
GVIPSLSNDAEFFPGLSKSWSYSFMVNDEEAPTGRPAGALGWAGLANLFYWIDRTNGFGG
FWATQILPFGDPVSFTGYVDFETAFYASLRAAKAA