Protein Info for Dshi_2281 in Dinoroseobacter shibae DFL-12

Annotation: periplasmic binding protein/LacI transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 29 to 233 (205 residues), 52.4 bits, see alignment E=5.7e-18 PF13407: Peripla_BP_4" amino acids 33 to 287 (255 residues), 62.3 bits, see alignment E=5.6e-21

Best Hits

KEGG orthology group: K11930, periplasmic protein TorT (inferred from 100% identity to dsh:Dshi_2281)

Predicted SEED Role

"Periplasmic protein torT precursor" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR94 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Dshi_2281 periplasmic binding protein/LacI transcriptional regulator (RefSeq) (Dinoroseobacter shibae DFL-12)
MLRTIISIGLAAGLWGVGPPVSAAAADRQVLCVLVPHFKDEYWLSVGFGLEEEARKQNVE
LLFFEAGGYRARATQIAQLERCAALGVDAILIGAVSSDHPDLTETLAQVSADTPVFGLIN
EIRSDALSARIGVDWTEMGHILGTFLRDRHPSGSEPKTAVLLTGPAESGWTGPLEAGLRD
GLAGSTVTILDIYRADTGLRQQLRLAEEALEHHPKVDYLIGSAPAIEAAIGLFASHAAPD
RPQMLATYVSHTIKRSLMNGNVLAASFDDPMFQARLAMLAAVSEAPGQARVVGPEVRLLR
AGDETLGQIPTSPAKYFPTLQ