Protein Info for Dshi_2275 in Dinoroseobacter shibae DFL-12

Annotation: single-stranded-DNA-specific exonuclease RecJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 203 to 220 (18 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 43 to 579 (537 residues), 489 bits, see alignment E=7.1e-151 PF01368: DHH" amino acids 94 to 244 (151 residues), 86.3 bits, see alignment E=3.2e-28 PF02272: DHHA1" amino acids 364 to 455 (92 residues), 63 bits, see alignment E=4.8e-21 PF17768: RecJ_OB" amino acids 470 to 579 (110 residues), 74.5 bits, see alignment E=9.9e-25

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to dsh:Dshi_2275)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR88 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Dshi_2275 single-stranded-DNA-specific exonuclease RecJ (RefSeq) (Dinoroseobacter shibae DFL-12)
MTDGPAFLGVESSLTGRRWIGLSPDQDRAAERLVQITGLPDAVCRTLARRGVAPEEAEDF
LAPTLRALLPDPRSLRDMERAAARVNAAIARNERIAIFADYDVDGGSSAALLIDWLRAQG
RTATLYVPDRIDEGYGPNIPAMEALADAHDLIICVDCGTLSHDPVAAAQGTDVVILDHHL
AEECLPAAHAVVNPNRQDEDGSLSHLCAAAVVFLLLVEANRQQRAAGQPGQDLMALLDLV
ALATVADVAPLSGVNRAFVRQGLTVMGRRERPGLTALSDSAGLDRAPSSYHLGFVLGPRI
NAGGRIGAADLGARLLATRDPHEAAALAERLEKLNAERRDIEAQVRASALEQAETRGLNA
PLAWAAGEGWHPGVVGIVASRLKETANRPAIVIGLEGDEGKGSGRSVPGIDLGAAIQRLA
HEGLLLKGGGHKMAAGLTVRRDLLEPAMARLSELLAAQGADRLGPKGLHVDGVLSPRAIT
TELITRIEDAGPFGASAPAPRFALPSVTIRYAKPVGESHLRFSFAGPCGTRMDGIAFGAF
DTPIGPALSQSARGTFHLAGRLEINSWGGQHKAQLRLDDAAAAEA