Protein Info for Dshi_2265 in Dinoroseobacter shibae DFL-12

Annotation: Sarcosine oxidase delta subunit heterotetrameric (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF04267: SoxD" amino acids 2 to 79 (78 residues), 95.2 bits, see alignment E=1e-31

Best Hits

Swiss-Prot: 49% identical to SOXD_RHIME: Sarcosine oxidase subunit delta (soxD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00304, sarcosine oxidase, subunit delta [EC: 1.5.3.1] (inferred from 100% identity to dsh:Dshi_2265)

Predicted SEED Role

"Sarcosine oxidase delta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR78 at UniProt or InterPro

Protein Sequence (87 amino acids)

>Dshi_2265 Sarcosine oxidase delta subunit heterotetrameric (RefSeq) (Dinoroseobacter shibae DFL-12)
MRIPCPLCGNRDLREFTYLGHETYLDRPAPGDAEALDSYLHLRDNPAGETGELWYHGLGC
GAWLHVQRNTVTHEIGAVTLASEKVAP