Protein Info for Dshi_2233 in Dinoroseobacter shibae DFL-12

Annotation: poly(R)-hydroxyalkanoic acid synthase, class I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 334 to 351 (18 residues), see Phobius details TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 71 to 599 (529 residues), 755 bits, see alignment E=1.9e-231 PF07167: PhaC_N" amino acids 113 to 284 (172 residues), 244.3 bits, see alignment E=6.2e-77 PF00561: Abhydrolase_1" amino acids 285 to 529 (245 residues), 39.2 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 40% identical to PHAC_RHIME: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to dsh:Dshi_2233)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR46 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Dshi_2233 poly(R)-hydroxyalkanoic acid synthase, class I (RefSeq) (Dinoroseobacter shibae DFL-12)
MTTESGGREVAGLEMGENLEKLNANVAKMEELSQRLVRAISQREAHDQGLQGPGTDVYMK
AASAYVAEVLNNPAKLMEHQVQYWGKTLKHVVEAQQMLAKGQLKAPRDEHAGDRRFKNPL
WDTHPYFNFVKQQYLISAESIEKAVADLDNLEPNDKKRVEFFSKQIVDLFSPANFLSTNP
DALEKAVETNGESLVRGLENLVRDIESHQGEHLVTLSDPSAFTVGENLATTEGSVVYRNR
MMELIQYAPKTETVCKTPLILFPPWINKFYILDLKPKNSLINWIVEQGYTLFVVSWVNPD
ETYADVSLDTYVEEGYMTAIEEVKKITGEKQVNAVGYCIAGTTLTSVLALMNKRGDKSVR
SATFFTTMTDFEDAGEMAVFLDDDFVDGIEREVASKGYLHSFFMSRTFSYLRANDLVYGP
AIRSYMMGEAPPAFDLLHWNGDSTNLPGKMVVQYLRDLCQGNKLAKGEFELCGEVLSLKD
MKTPAMAIACETDHIAHWKGSFNGFKQFGSRDKTFIVSESGHIAGIVNPPSKMKYGHYTN
DGPMEDPETWLASAEYHEGSWWPRWSEWLKRRSGAQVPARQPGDATHPALAAAPGEYVVA
RVDG