Protein Info for Dshi_2224 in Dinoroseobacter shibae DFL-12

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 34 to 135 (102 residues), 44.1 bits, see alignment E=1.2e-15 PF00528: BPD_transp_1" amino acids 52 to 249 (198 residues), 61.6 bits, see alignment E=4.4e-21

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_2224)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR37 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Dshi_2224 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSCWQTVQDYALRSIGHGERLLPRSDFTLCEQFTLIGSGLIWNVYFGAFALLFGFFLATA
VALGKASDRAVLRVPADWFIFVFRGSPLFIQFFLAYFLFIQLKAVSPAFDPFTSAWAGAL
VVLFLNTSAYAGEIFYGALRSVPKGDLEAADAYGLAGWTKFRRVTWPTMLRLAWPSYTNE
AIFLFHATTLVFFAGFPAFQQRGDALYYAQYFADKTFNPFIPYPIVAFYFILLTLAVIFV
FSLINRRLNRHLAPHVRPKLRLRPQLVR