Protein Info for Dshi_2223 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 53 to 278 (226 residues), 66.3 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_2223)

Predicted SEED Role

"ABC transporter, permease protein, HisMQ family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR36 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dshi_2223 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MFAFCADPSTLSGLTWLSCYLTTGKHMAFYGSFGTVMLLLVVTAPAALFLGFGGAIAARS
QIAPLRWLGKGYTSMVRGIPDIAFFLFVPIALDQGLEYLRHHWKCPDWTQAVRQGNDFVV
CAEAKLPLSTSPQWVHETYGFTLAVIAFAVVFGAFAANVLYGAMTAVPRAQIETAEAYGM
TRRQAFWRILVPQMWVYALPGLSNLWQILVKATPLLFLLGIEDIVYWARELGGVQSARFS
DYPHGDWRLWYFLGLLVFYLALTSVSERIFARLMQRLSHGQATMAGEAQRKAPAT