Protein Info for Dshi_2222 in Dinoroseobacter shibae DFL-12

Annotation: extracellular solute-binding protein family 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 27 to 236 (210 residues), 122.2 bits, see alignment E=1.3e-39 PF10613: Lig_chan-Glu_bd" amino acids 69 to 111 (43 residues), 32.6 bits, see alignment 7.5e-12

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to dsh:Dshi_2222)

Predicted SEED Role

"His/Glu/Gln/Arg/opine family ABC transporter, periplasmic His/Glu/Gln/Arg/opine family-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR35 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Dshi_2222 extracellular solute-binding protein family 3 (RefSeq) (Dinoroseobacter shibae DFL-12)
MKTLIFGTALATLMAGAAFAASDGTTVRMGTEGAYPPYNFLNDAGEVDGFERELGDELCA
RAELTCEWVTNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYTQPDPSAFMGLS
EDVDLEGGVIAAQTGTIQASHIASTGATLIEFASPDETVAAVRNGEADAVLADKAFLEPF
VTENADLVFVGEDVLLGGGIGMGLRESDPELRAKFDAAIQSMKDDGSLNALIAKWLPGSA
LF