Protein Info for Dshi_2155 in Dinoroseobacter shibae DFL-12

Annotation: Phosphoglycerate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00162: PGK" amino acids 6 to 382 (377 residues), 472.8 bits, see alignment E=4.1e-146

Best Hits

Swiss-Prot: 100% identical to PGK_DINSH: Phosphoglycerate kinase (pgk) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 100% identity to dsh:Dshi_2155)

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQM4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Dshi_2155 Phosphoglycerate kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTWKTLDDMALDGKIVLTRVDINVPVADGVVTDTTRIERIVPTVTDILAKGGLPVLLAHF
GRPKGKVVPEMSLRVVLPALEEALGRPVEFIAHPDRAALEALPKCTVVLAENTRFAPGEE
KNDPEMAAALAALGDIYCNDAFSAAHRAHASTEGIARLLPSCAGRLMQAELEALQRALGT
PTRPVVAVVGGAKVSTKLALLGNLVEKVDDLVIGGGMANTFLAAQGIDVGASLAEHEMAD
TAREIMEKAARAGCSIHLPKDIVVARKFEAGAPSQTLPVSECPRDAMILDAGPETVAALK
EVFAQARTLIWNGPLGAFEIPPFDMATNAAARAAADATKAGTLITVAGGGDTVAALNKAG
VADDFTYISTAGGAFLEWMEGKTLPGVAALEAA