Protein Info for Dshi_2150 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function UPF0075 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03702: AnmK" amino acids 9 to 350 (342 residues), 223.4 bits, see alignment E=2.5e-70

Best Hits

Swiss-Prot: 60% identical to ANMK_RHOS4: Anhydro-N-acetylmuramic acid kinase (anmK) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to dsh:Dshi_2150)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQL9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Dshi_2150 protein of unknown function UPF0075 (RefSeq) (Dinoroseobacter shibae DFL-12)
MKGKPLWALGCMSGTSLDGVDAALVLTDGERVLEQGPSAYRPYSATERAALRAVLGRWPG
PGLEAALAVVQSAHAEIISGFQDVEIVGFHGQTLAHGPRGAGTHQLGDGAALSQALGVPV
VWDFRSVDVSLGGEGAPLAPIYHWAVARHARLENPVCFLNLGGVGNLTYVDPSKGPEAIL
AFDTGPANAPIDDLVLGRTGQPFDTGGALAAEGQIVQPIIDRLLDQDYFVRKPPKSLDRN
DFYWLLEAVCELETPDAVATLTACAAAAVAAGVSLMPQAPSAIVLCGGGRKNNYMKQSIA
KFTSCDVTDVDALGFDGDMIEAQAFGFMAVRVLNGAPTSFPGTTGVAAPVGGGVTSGLN