Protein Info for Dshi_2117 in Dinoroseobacter shibae DFL-12

Annotation: sarcosine oxidase, beta subunit family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01373: sarcosine oxidase, beta subunit family" amino acids 4 to 409 (406 residues), 708.2 bits, see alignment E=1.4e-217 PF01946: Thi4" amino acids 32 to 72 (41 residues), 29.6 bits, see alignment 8.3e-11 PF01266: DAO" amino acids 34 to 381 (348 residues), 235.9 bits, see alignment E=2e-73 PF00890: FAD_binding_2" amino acids 34 to 252 (219 residues), 26 bits, see alignment E=1.1e-09 PF13450: NAD_binding_8" amino acids 37 to 86 (50 residues), 23.7 bits, see alignment 9.6e-09

Best Hits

Swiss-Prot: 60% identical to SOXB_CORS1: Sarcosine oxidase subunit beta (soxB) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 100% identity to dsh:Dshi_2117)

MetaCyc: 60% identical to sarcosine oxidase beta subunit (Corynebacterium sp.)
RXN-22742 [EC: 1.5.3.24]

Predicted SEED Role

"Sarcosine oxidase beta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1 or 1.5.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQI6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Dshi_2117 sarcosine oxidase, beta subunit family (RefSeq) (Dinoroseobacter shibae DFL-12)
MTHFSAMSLLKNALTGHKNWPEQWPDKQPKDEYDVIIVGAGGHGLGAAYYLAKEHGITNV
AVIEKGWLGGGNTGRNTTIIRSNYLYDESAKLYDHALDLWENLSTELNYNVMYSKRGVMM
LAHNVHDVQSFQRHIHANRLNGVDNQWLTPKQAKEFCPPLNISPDARYPVMGAALQKRAG
TARHDAVAWGYARAAAKRGVDIIQNCPVIAIRRAADGSVEGVDTAKGFIKAKKVAVSAAG
HTSVVMDSAGVRMPLESYPLQALVSEPIKPVFPCVVMSNTVHAYISQSDKGELVIGSGTD
QYTSYSQRGGLPLIEHTVSAICEVFPIFNRMRMLRKWGGIVDVTPDRSAILGKTPVKGLY
VNCGWGTGGFKATPGAAHTLAWTVAKDEPHPINAPFTLERFTTGRLIDEAAAAAVAH