Protein Info for Dshi_2098 in Dinoroseobacter shibae DFL-12

Annotation: type I secretion outer membrane protein, TolC family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 25 to 418 (394 residues), 309.4 bits, see alignment E=2e-96 PF02321: OEP" amino acids 37 to 209 (173 residues), 85.5 bits, see alignment E=2e-28 amino acids 235 to 410 (176 residues), 81 bits, see alignment E=4.8e-27

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 100% identity to dsh:Dshi_2098)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPY1 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Dshi_2098 type I secretion outer membrane protein, TolC family (RefSeq) (Dinoroseobacter shibae DFL-12)
MFSKFVRHTVLGAAVLCAASGAAMAQSLTDALVDTYKNSELIEQSRALLRSADEDVAIAV
SRLRPILNYSADYGYSDNFGRETDNGSLGITASLLLFDFGRTRLGIEANKELVLATREAL
RATEQDVLLEGVSAFLNVRGANDNVDLRRNNVRVITEQLRAARDRFEVGEVTRTDVAQAE
ARLAEANANLTRALGQQAAAREVYRAVVGQFPQSLAPPPPSPAIPATVEEATSIAERTHP
SILQGRHNVRASEIVAEVAQKAILPTASATANISRSIRDSLDDTTDSSIGLTLSGPIYQG
GGLSAQYRQALAGVENARATLNQSVLVIRQRVGIAWAEILVTRANIDSTRRQVEAAEIAF
EGVTEEARLGARTTLDVLDAEQDVLDARTALLSAEISAVQAVYDLLSAMGLMTVDYLGLP
VPTYDPAAYFNAVSNAPATSTQGARLDRVLQSIMRD