Protein Info for Dshi_2029 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, LacI family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00356: LacI" amino acids 20 to 65 (46 residues), 70.9 bits, see alignment 1.2e-23 PF00532: Peripla_BP_1" amino acids 77 to 321 (245 residues), 84.3 bits, see alignment E=2.1e-27 PF13407: Peripla_BP_4" amino acids 79 to 327 (249 residues), 62.2 bits, see alignment E=1.2e-20 PF13377: Peripla_BP_3" amino acids 189 to 345 (157 residues), 112.9 bits, see alignment E=3.5e-36

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to dsh:Dshi_2029)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPR4 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Dshi_2029 transcriptional regulator, LacI family (RefSeq) (Dinoroseobacter shibae DFL-12)
MVDRTTNRRVARKPATPSPTLQDVAQAAGVSTATVSRCLNSPELVVEQTRERVLAVVQEL
GYAPNFGARALAAKRTNTIGAIIPTMENAIFARGLQAFQEELARHGLTLLVASSSYSPKL
EEEQIRTLLARGADALLLIGFERSARAYELLQQRGVPYVIAWAYSAGSDHHAIGFDNRAA
MRALARQVFGLGHRDVAIIAAPMDSNDRARERVLGIWDAAAEVGLDRDALTLVQTPYSIE
NGARVMAEILAGPRQPTAVMCGNDVLAVGAMGAARAAGLSVPGDLSITGFDDIEIAGIVT
PGLTTVHVPHRQMGIEAARVLATLLSGGAPPVPLLLETQIISRASLGPVSGT