Protein Info for Dshi_2024 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF81 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details PF01925: TauE" amino acids 12 to 243 (232 residues), 85.5 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dsh:Dshi_2024)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPQ9 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Dshi_2024 protein of unknown function DUF81 (RefSeq) (Dinoroseobacter shibae DFL-12)
MPALDPVALLAIFAALALGGTVKGATGAGAPVIAVPVIAAFYDVRLGVMIMAMPNLLSNS
WQLWRYRAHLIPGGFTWMLAGGAAAGCLAGTFLLAVLPDRVLLLAVAFGVAVYIGLRLAR
PEFRLALDTARRIVWPVSLGAGLLQGAAGISAPITLSYLNAMRLARPVFIATVSTCFIGM
AVVQVPALFATGLLTLPVFGLSVAALAPILLFMPLGAWLARKMSAEGFDKLVLGLLSALA
ARLFYVALTGG