Protein Info for Dshi_1991 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 41 to 315 (275 residues), 131.1 bits, see alignment E=1e-41 PF00005: ABC_tran" amino acids 381 to 531 (151 residues), 101.9 bits, see alignment E=7.1e-33

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to dsh:Dshi_1991)

Predicted SEED Role

"FIG00730022: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP48 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Dshi_1991 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MARSGSRPSSLAETAPGLRRVLRRLAPFMRDERPLIAGGALAMLAAVFAKLAEPWPLKFV
IDMFVPGRGGTEPGMPFGLTDPIMLLVLCALSIVLVMGLRATFEFTARVTFALAGARVLA
KVRATLFEHLQRLPVAFHQKSRPGDLTLRLISDVGMLKETTVTAALPLAVNALVLVGMIA
VMLWIDWQLALIALSPLPVLWLMTMRIGRRIQSVSRKTRKTEGAMAASASEAMSNVAIVQ
ALGLEKAMSKDFLGDNAAELKQGVQSKRLTAGLERRVDILVGVGIGLVLLFGGLSILDGR
TTPGDLIVFLTYLKNTFKPVRDYAKYAARLAKATAAGERVIALLDEDTKLTSLATPVKLP
ETQGGIAFENVSLNLGGSEILKDISISIRAGERVAITGPSGSGKSTLLSLAMRLQDPDAG
AVRLDGRDLRALAVEDVRDSFAFVPQDPVLFHASIARNLGIAARHEPTPDEIIAAAQLAG
AHDFILSQPQGYDTVLAERGSTLSGGQRQRLSFTRAALRNAPIFLLDEPTTGLDATTQAN
LADAIWQLTENRTLLMVTHDLHLAARADRVICLEGGRIVANGRHEDVLAQGGLYAKLWAE
QMQTGVAHAAE