Protein Info for Dshi_1978 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 287 (280 residues), 142.6 bits, see alignment E=7e-46

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_1978)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP35 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Dshi_1978 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MIGLVSYLVFFATIASILAIAVLGLNLHWGNTGLFNGGVVAFFGAGGYATLILGGTPQAA
HLGGFGLPYGLALLGGLVIAGLLAWLVGLLTIRLRHDYLAIATFGVAVAFENLVRNAQRL
AGGASGLRGFERPLADTIPPGLAYNAAFFAFVLAALIATYLGLERLIRGPFGRLLRAIRE
DETAARALGKSPDRIRLTAFVIGSVILGLAGALYATFYAFISPQDVLPILTFQIWAMLIV
GGAGNNRGAIAGAFLIWGAWTASGWALSRFAPIEVQLYTGSIQFVLIGCVIVGMLLWRPQ
GLFPERLVVSQSGQTDR