Protein Info for Dshi_5002 in Dinoroseobacter shibae DFL-12

Name: xerC
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF02899: Phage_int_SAM_1" amino acids 15 to 97 (83 residues), 50.3 bits, see alignment E=2.4e-17 PF00589: Phage_integrase" amino acids 142 to 294 (153 residues), 110.9 bits, see alignment E=6.3e-36

Best Hits

Swiss-Prot: 50% identical to XERC_RHILO: Tyrosine recombinase XerC (xerC) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_5002)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C5ZZD8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Dshi_5002 hypothetical protein (NCBI) (Dinoroseobacter shibae DFL-12)
MAHAALSPACADQLETWLTHLRALDDSPASTLSAYQRDVAGFLGFLARHDGGLASPARLR
RITQSDMRAWMAAERRRGLGARSLARALSAVKSFFRWVGERDGFEPTAVLAARSPKYQRK
LPRPLAEDAALEMIAQVELQAADSWIAARDVAVVTLLYGCGLRISEALGLTGAAAPLPEV
LTIRGKGDKERIVPVLPAARTAVDTYLRLSPHPLEKDGPLFRGKRGGQLNPRVIAKVMEQ
ARMQLGLPSSATPHAMRHSFATHLLAAGGDLRAIQELLGHASLSTTQAYTAVDATRLLEV
YNAAHPKA