Protein Info for Dshi_1902 in Dinoroseobacter shibae DFL-12

Annotation: membrane bound O-acyl transferase MBOAT family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 30 to 56 (27 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details PF03062: MBOAT" amino acids 148 to 343 (196 residues), 111.8 bits, see alignment E=2.2e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1902)

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LND1 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Dshi_1902 membrane bound O-acyl transferase MBOAT family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MVFSTPIFLFGFLPVFLAAYYLVPRAGRNWLILLASTLFYAWWRTDALIVLYVVAGSSYA
AAKLATQTRDATVKTWAVRAGVAVNLAILGWFKYTTFILGNLNTALGGDALTVPEIILPI
GLSFLTFQSISYILDVARGDAPPARKLSDFLAFSSLFPQLIAGPVLRYKDLAHQFETREH
SVALFCRGARRFIEGLAMKLLIADSVAPLADRIFALSDPTVAEAWLGALAYSIQLLFDFA
GYSAMAIGLGLMIGFHFPENFDAPYTSRSITEFWRRWHISLSRWLRDYLYVPLGGNRGGR
LRTYRNLVLTMVLGGIWHGANWTFVVWGLWHGGLMALERALGAKHRDTVWPRLLAWPVTM
ICVVLGWVVFRAASLGEAMTMYAGMFGAHGLPLRAETVLLTAPTEVICLALGMVLSMAPR
PALHPVAWAARLQPAALSMLCLIAVQARTVSPFLYFQF