Protein Info for Dshi_1900 in Dinoroseobacter shibae DFL-12

Annotation: Phosphomannomutase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF02878: PGM_PMM_I" amino acids 7 to 133 (127 residues), 126.2 bits, see alignment E=1.6e-40 PF02879: PGM_PMM_II" amino acids 152 to 256 (105 residues), 58.5 bits, see alignment E=1.7e-19 PF02880: PGM_PMM_III" amino acids 261 to 367 (107 residues), 83.2 bits, see alignment E=3.1e-27 PF00408: PGM_PMM_IV" amino acids 376 to 452 (77 residues), 42.8 bits, see alignment E=8.8e-15

Best Hits

Swiss-Prot: 50% identical to MANB_ECO57: Phosphomannomutase (manB) from Escherichia coli O157:H7

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to dsh:Dshi_1900)

MetaCyc: 50% identical to phosphomannomutase (Escherichia coli K-12 substr. MG1655)
Phosphomannomutase. [EC: 5.4.2.8]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNC9 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Dshi_1900 Phosphomannomutase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSKLACFKAYDVRGRIGDTLDTEIAQDVGRAVAEVLGARCVVVGRDIRDSSPALCEALGA
GLRAAGADVRDIGLCGTEEVYFATDHLDACAGVMVTASHNPIDYNGFKIVGRGARPLPDA
QFRAIERLAATRAFAAPTAQSGTHLEADTRAAYVARVCSFVDPAALGPVHVVANAGNGCA
GSTFDAVIAALEAGGAKIEVTRLHHAPDARFPNGIPNPLLPENQPATSAAITRAGADLGI
AWDGDFDRCFFFDETGAFIPGEFVVGLLAEAILEQTPGASIVYDPRVVWNTRRIVEAAGG
AAVLSKTGHVLVKDTMRRNDAAYGGEMSAHHYFRDFMFCDSGMIPWLLMLERLSKSGRPL
SAAVAEMRRRHPSSGEINFRVSDAARVMATLRQHYADSAEHIDTLDGVSMEFADWRFNLR
ASNTEPLLRLNVETLESAALLDRRVGEIRSMIEAAA