Protein Info for Dshi_1897 in Dinoroseobacter shibae DFL-12

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 2 to 468 (467 residues), 573 bits, see alignment E=2.5e-176 PF00483: NTP_transferase" amino acids 4 to 285 (282 residues), 144.1 bits, see alignment E=8.5e-46 PF01050: MannoseP_isomer" amino acids 315 to 465 (151 residues), 207.3 bits, see alignment E=1.7e-65 PF07883: Cupin_2" amino acids 382 to 449 (68 residues), 36.9 bits, see alignment E=3.7e-13

Best Hits

Swiss-Prot: 44% identical to MANC_SALTY: Mannose-1-phosphate guanylyltransferase ManC (manC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to dsh:Dshi_1897)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.22, 5.3.1.8

Use Curated BLAST to search for 2.7.7.22 or 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNC6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Dshi_1897 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (RefSeq) (Dinoroseobacter shibae DFL-12)
MIIPVILAGGSGSRLWPASRKSYPKQFTELVGARSLFQDTLARLQGPHFAAPTIITGDDF
RFITAEQLDDAGVTGADILLEPAGRNTAPAILAAALRHEATPDAVLLVSPSDHRIADGAA
FLDAVAAGKAAAEEGHLVTFGVTPIAAETGYGYLELSGTPVPGQPQVLKSFVEKPDAAQA
AQLLAAGRHLWNAGIFMFKVGTIIDAFERLAPRLVMPVRAAMAAGEDDLCFYRLGAQAYA
RCEDISIDYAIMEAAEALRVIPVSCGWTDLGSWRSVHGASDQDTEGNTVQGSALQIDCRN
SLLKSTAPGTRLVGLGLQNIAAIATDDAILVANLDDSERVKEVVAALKVQGASQAESFRR
CHRPWGYFETLSLGERFQVKRIMVKPGAALSLQSHFHRAEHWVVVEGSAHVTVDRDVSLI
SENQSVYIPLGAVHRLENRGKVPLNLIEVQSGAYLGEDDIVRYEDVYARAPKQNVA