Protein Info for Dshi_1860 in Dinoroseobacter shibae DFL-12

Annotation: preprotein translocase, YajC subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00739: preprotein translocase, YajC subunit
  • amino acids 17 to 98 (82 residues), 97.2 bits, E=2.3e-32
• PF02699: YajC
  • amino acids 19 to 95 (77 residues), 106.8 bits, E=2.1e-35

Best Hits

Swiss-Prot: 52% identical to YAJC_BRUME: Sec translocon accessory complex subunit YajC (yajC) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to dsh:Dshi_1860)

MetaCyc: 37% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

See A8LN89 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dshi_1860 preprotein translocase, YajC subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MFATPAYAQAAGAGGAFTSFIPLILIFAIMYFLLIRPQQKKVKEHKKMVEALRRGDQIVT
QGGLIGKVTKVVDDNEVKVEIATGTEVRVVRHTIQQVLTKTEPAS