Protein Info for Dshi_1849 in Dinoroseobacter shibae DFL-12

Annotation: Nitrile hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF02979: NHase_alpha" amino acids 22 to 201 (180 residues), 272 bits, see alignment E=9.6e-86 TIGR01323: nitrile hydratase, alpha subunit" amino acids 27 to 201 (175 residues), 257.4 bits, see alignment E=6.5e-81

Best Hits

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 100% identity to dsh:Dshi_1849)

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN78 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Dshi_1849 Nitrile hydratase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPHDHAAPHPHRPDQDGPLTEAQLTEIALRELLIEKGVLTPAEVTAQVTQMDARSPANGA
AVVARAWTDPAFRARLLADGAEACREMGYDIGTLNLIAVENTPEVHNVIVCTLCSCYPRN
LLGLPPDWYKSRAYRSRTVKDPRGVLAEFGTELPRGMTVRVHDSTADMRYIVIPQRPAGT
ETLSPEALAALVTRDGMIGVTRL