Protein Info for Dshi_1833 in Dinoroseobacter shibae DFL-12

Annotation: Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details PF04290: DctQ" amino acids 24 to 150 (127 residues), 95.6 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1833)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component / Taurine transporter, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN62 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Dshi_1833 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq) (Dinoroseobacter shibae DFL-12)
MTKFWHIVDNIESYICRTLLAIFVCLLFLQVIVRTLFDFSFSWVEELSIYMFVWFVFFGA
SYAAKMGAHNRVTFQFKFLPPRKIKYIEAFADLFWIFFNVYFVYLAIDFIFNKMNRFQSS
QTMGFHLSWVYIVLPIAFSLMTFRVLQVNYRKIVLGEDLRDPDAIDLDEVRAGTDDAARK
PRRDEEQN